PDB entry 1rea

View 1rea on RCSB PDB site
Description:
Deposited on 1991-12-19, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-23, with a file datestamp of 2000-06-23.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1rea_1, d1rea_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1rea_ (-)
    aidenkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgr
    iveiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpd
    tgeqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklag
    nlkqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgs
    etrvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykgekigq
    gkanatawlkdnpetakeiekkvrelllsnpnstpdfsvddsegvaetnedf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rea_ (-)
    denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
    eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
    eqaleicdalarsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntlli
    finqitggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqily
    geginfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvr
    elll