PDB entry 1rea

View 1rea on RCSB PDB site
Description: structure of the reca protein-adp complex
Deposited on 1991-12-19, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-23, with a file datestamp of 2000-06-23.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.223
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1rea_ (-)
    denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
    eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
    eqaleicdalarsgavdvivvdsvaaltpkaeiegeigdshmglaarmmsqamrklagnl
    kqsntllifinqirmkigvmfgnpetttggnalkfyasvrldirrigavkegenvvgset
    rvkvvknkiaapfkqaefqilygeginfygelvdlgvkekliekagawysykgekigqgk
    anatawlkdnpetakeiekkvrelll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rea_ (-)
    denkqkalaaalgqiekqfgkgsimrlgedrsmdvetistgslsldialgagglpmgriv
    eiygpessgkttltlqviaaaqregktcafidaehaldpiyarklgvdidnllcsqpdtg
    eqaleicdalarsgavdvivvdsvaaltpkaeieglaarmmsqamrklagnlkqsntlli
    finqitggnalkfyasvrldirrigavkegenvvgsetrvkvvknkiaapfkqaefqily
    geginfygelvdlgvkekliekagawysykgekigqgkanatawlkdnpetakeiekkvr
    elll