PDB entry 1re9

View 1re9 on RCSB PDB site
Description: crystal structure of cytochrome p450-cam with a fluorescent probe d-8-ad (adamantane-1-carboxylic acid-5-dimethylamino-naphthalene-1-sulfonylamino-octyl-amide)
Class: oxidoreductase
Keywords: Monooxygenase, Conformational States, Substrate-linked Sensitizers, SUBSTRATE-BINDING, DANSYL, ADAMANTANE, ADAMANTANE-1-CARBOXYLIC ACID, 4-(5-DIMETHYLAMINO-NAPHTHALENE-1-SULFONYLAMINO)-OCTYL]-AMIDE, CHANNEL, OXIDOREDUCTASE
Deposited on 2003-11-06, released 2004-11-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.16
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450-cam
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1re9a_
  • Heterogens: K, HEM, DSO, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1re9A (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re9A (A:)
    laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
    ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
    iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
    mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
    dtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgv
    qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
    lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav