PDB entry 1re6

View 1re6 on RCSB PDB site
Description: Localisation of Dynein Light Chains 1 and 2 and their Pro-apoptotic Ligands
Class: contractile protein
Keywords: dynein light chain, apoptosis, dimer, CONTRACTILE PROTEIN
Deposited on 2003-11-06, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dynein light chain 2
  Species: Mus musculus [TaxId:10090]
  Gene: DLC2
  Database cross-references and differences (RAF-indexed):
  • GB NP_080832 (5-93)
    • cloning artifact (0-4)
  Domains in SCOPe 2.07: d1re6a1, d1re6a2
• Chain 'B':
  Compound: dynein light chain 2
  Species: Mus musculus [TaxId:10090]
  Gene: DLC2
  Database cross-references and differences (RAF-indexed):
  • GB NP_080832 (5-93)
    • cloning artifact (0-4)
  Domains in SCOPe 2.07: d1re6b1, d1re6b2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1re6A (A:)
  gplgsmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwh
  civgrnfgsyvthetkhfiyfylgqvaillfksg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1re6B (B:)
  gplgsmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwh
  civgrnfgsyvthetkhfiyfylgqvaillfksg