PDB entry 1re6

View 1re6 on RCSB PDB site
Description: Localisation of Dynein Light Chains 1 and 2 and their Pro-apoptotic Ligands
Class: contractile protein
Keywords: dynein light chain, apoptosis, dimer
Deposited on 2003-11-06, released 2004-03-23
The last revision prior to the SCOP 1.73 freeze date was dated 2004-03-23, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dynein light chain 2
    Species: MUS MUSCULUS
    Gene: DLC2
    Database cross-references and differences (RAF-indexed):
    • GB NP_080832 (5-93)
      • cloning artifact (0-4)
    Domains in SCOP 1.73: d1re6a_
  • Chain 'B':
    Compound: dynein light chain 2
    Species: MUS MUSCULUS
    Gene: DLC2
    Database cross-references and differences (RAF-indexed):
    • GB NP_080832 (5-93)
      • cloning artifact (0-4)
    Domains in SCOP 1.73: d1re6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1re6A (A:)
    gplgsmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwh
    civgrnfgsyvthetkhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1re6B (B:)
    gplgsmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwh
    civgrnfgsyvthetkhfiyfylgqvaillfksg