PDB entry 1re6
View 1re6 on RCSB PDB site
Description: Localisation of Dynein Light Chains 1 and 2 and their Pro-apoptotic Ligands
Class: contractile protein
Keywords: dynein light chain, apoptosis, dimer, CONTRACTILE PROTEIN
Deposited on
2003-11-06, released
2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: dynein light chain 2
Species: Mus musculus [TaxId:10090]
Gene: DLC2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1re6a1, d1re6a2 - Chain 'B':
Compound: dynein light chain 2
Species: Mus musculus [TaxId:10090]
Gene: DLC2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1re6b1, d1re6b2
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1re6A (A:)
gplgsmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwh
civgrnfgsyvthetkhfiyfylgqvaillfksg
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1re6B (B:)
gplgsmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwh
civgrnfgsyvthetkhfiyfylgqvaillfksg