PDB entry 1re4

View 1re4 on RCSB PDB site
Description: crystal structure of fragment d of bbetad398a fibrinogen
Deposited on 2003-11-06, released 2004-05-25
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1re4A (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4A (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqvia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1re4B (B:)
    hqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsg
    keceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdp
    ykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahygg
    ftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlts
    dprkqcskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmr
    kmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4B (B:)
    detvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgkecee
    iirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpykqgf
    gnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggftvqn
    eankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdprkq
    cskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkmsmk
    irpffp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1re4C (C:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrltig
    egqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4C (C:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1re4D (D:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4D (D:)
    kvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1re4E (E:)
    hqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsg
    keceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdp
    ykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahygg
    ftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlts
    dprkqcskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmr
    kmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4E (E:)
    rvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgkeceeiirkggetsemy
    liqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpykqgfgnvatntdgkny
    cglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggftvqneankyqisvnky
    rgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdprkqcskeagggwwyn
    rchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkmsmkirpffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1re4F (F:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrltig
    egqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4F (F:)
    hdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdiankgak
    qsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfghlsptg
    ttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrltyayfa
    ggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwmnkchag
    hlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrlt