PDB entry 1re2

View 1re2 on RCSB PDB site
Description:
Deposited on 1998-11-05, released 1999-05-05
The last revision prior to the SCOP 1.63 freeze date was dated 1999-05-05, with a file datestamp of 1999-05-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.171
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1re2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1re2A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv