PDB entry 1re0

View 1re0 on RCSB PDB site
Description: Structure of ARF1-GDP bound to Sec7 domain complexed with Brefeldin A
Class: protein transport
Keywords: all-helical, alph-beta, PROTEIN TRANSPORT
Deposited on 2003-11-06, released 2003-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1re0a_
  • Chain 'B':
    Compound: ARF guanine-nucleotide exchange factor 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Gea1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47102 (6-220)
      • cloning artifact (0-5)
    Domains in SCOPe 2.07: d1re0b1, d1re0b2
  • Heterogens: MG, GDP, AFB, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1re0A (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re0A (A:)
    mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
    wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
    eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1re0B (B:)
    gshmasdrktefilcvetfnekakkgiqmliekgfidsdsnrdiasflflnngrlnkkti
    glllcdpkktsllkefidlfdfkglrvdeairilltkfrlpgesqqieriveafsskysa
    dqsndkveledkkagkngsesmteddiihvqpdadsvfvlsysiimlntdshnpqvkdhm
    tfddysnnlrgcyngkdfprwylhkiytsikvkeivmpeeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re0B (B:)
    gshmasdrktefilcvetfnekakkgiqmliekgfidsdsnrdiasflflnngrlnkkti
    glllcdpkktsllkefidlfdfkglrvdeairilltkfrlpgesqqieriveafsskysa
    dqsvqpdadsvfvlsysiimlntdshnpqvkdhmtfddysnnlrgcyngkdfprwylhki
    ytsikvkeivmpeeh