PDB entry 1rdv

View 1rdv on RCSB PDB site
Description: rubredoxin from desulfovibrio vulgaris miyazaki f, trigonal crystal form
Class: electron transfer
Keywords: electron transfer, rubredoxin, metalloprotein, sulfate-reducing bacterium, iron-sulfur protein
Deposited on 1998-09-30, released 1999-05-18
The last revision prior to the SCOP 1.75 freeze date was dated 1999-05-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio vulgaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1rdva_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdvA (A:)
    mkkyvctvcgyeydpaegdpdngvkpgtafedvpadwvcpicgapksefepa