PDB entry 1rdu

View 1rdu on RCSB PDB site
Description: nmr structure of a putative nifb protein from thermotoga (tm1290), which belongs to the duf35 family
Deposited on 2003-11-06, released 2004-07-06
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1rdua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rduA (A:)
  marvaipsvgkdlssmvsdrfaraeyfiiydtesgnvevventiadahgtgpkvvqslvs
  kgveyliasnvgrnafetlkaagvkvyrfeggtvqeaidafsegrleelttftreg