PDB entry 1rdp

View 1rdp on RCSB PDB site
Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV3
Deposited on 2003-11-05, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-26, with a file datestamp of 2004-10-26.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.132
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Domains in SCOP 1.71: d1rdpd_
  • Chain 'E':
    Domains in SCOP 1.71: d1rdpe_
  • Chain 'F':
    Domains in SCOP 1.71: d1rdpf_
  • Chain 'G':
    Domains in SCOP 1.71: d1rdpg_
  • Chain 'H':
    Domains in SCOP 1.71: d1rdph_

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdpD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdpE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdpF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdpG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdpH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman