PDB entry 1rdd

View 1rdd on RCSB PDB site
Description: crystal structure of escherichia coli RNAse hi in complex with mg2+ at 2.8 angstroms resolution: proof for a single mg2+ site
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1993-06-23, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rdda_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rddA (A:)
    mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercdelaraaamnptledtgyqvev