PDB entry 1rda

View 1rda on RCSB PDB site
Description: crystal structures of ribonuclease hi active site mutants from escherichia coli
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1993-06-23, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease H
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Y4 (0-154)
      • conflict (9)
    Domains in SCOPe 2.06: d1rdaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdaA (A:)
    mlkqveiftngsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
    ehcevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
    vkghaghpenercdelaraaamnptledtgyqvev