PDB entry 1rd8

View 1rd8 on RCSB PDB site
Description: Crystal Sructure of the 1918 Human H1 Hemagglutinin Precursor (HA0)
Class: Viral protein
Keywords: GLYCOPROTEIN, MEMBRANE-FUSION PRECURSOR, VIRUS/VIRAL PROTEIN, Viral protein
Deposited on 2003-11-05, released 2004-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.271
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • GB AAD17229 (8-334)
      • cloning artifact (7)
    Domains in SCOPe 2.06: d1rd8a1, d1rd8a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • GB AAD17229 (0-174)
    Domains in SCOPe 2.06: d1rd8b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • GB AAD17229 (8-334)
      • cloning artifact (7)
    Domains in SCOPe 2.06: d1rd8c1, d1rd8c2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • GB AAD17229 (0-174)
    Domains in SCOPe 2.06: d1rd8d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • GB AAD17229 (8-334)
      • cloning artifact (7)
    Domains in SCOPe 2.06: d1rd8e1, d1rd8e2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Gene: Hemagglutinin
    Database cross-references and differences (RAF-indexed):
    • GB AAD17229 (0-174)
    Domains in SCOPe 2.06: d1rd8f_
  • Heterogens: NAG, NDG, PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rd8A (A:)
    adpgylledticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplql
    gkcniagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfe
    kfeifpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgke
    vlvlwgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywt
    llepgdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpf
    qnihpvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd8A (A:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniag
    wllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpk
    tsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgv
    hhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdt
    itfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvt
    igecpkyvrstklrmatglrnipsiqsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rd8B (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd8B (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rd8C (C:)
    adpgylledticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplql
    gkcniagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfe
    kfeifpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgke
    vlvlwgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywt
    llepgdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpf
    qnihpvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd8C (C:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniag
    wllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpk
    tsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgv
    hhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdt
    itfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvt
    igecpkyvrstklrmatglrnipsiqsr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rd8D (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd8D (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rd8E (E:)
    adpgylledticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplql
    gkcniagwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfe
    kfeifpktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgke
    vlvlwgvhhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywt
    llepgdtitfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpf
    qnihpvtigecpkyvrstklrmatglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd8E (E:)
    edticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniag
    wllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpk
    tsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgv
    hhpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdt
    itfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvt
    igecpkyvrstklrmatglrnipsiqsr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rd8F (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidgvrslv
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd8F (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnreeidg