PDB entry 1rd6

View 1rd6 on RCSB PDB site
Description: Crystal Structure of S. Marcescens Chitinase A Mutant W167A
Class: hydrolase
Keywords: Chitinase A, HYDROLASE
Deposited on 2003-11-05, released 2004-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase a
    Species: Serratia marcescens [TaxId:615]
    Gene: CHIA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07254 (Start-562)
      • see remark 999 (138)
      • see remark 999 (143)
      • engineered (166)
      • see remark 999 (225)
      • see remark 999 (394)
      • see remark 999 (436)
      • see remark 999 (472)
      • see remark 999 (483)
    Domains in SCOPe 2.04: d1rd6a1, d1rd6a2, d1rd6a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rd6A (A:)
    mrkfnkpllalligstlcsaaqaaapgkptiawgntkfaivevdqaataynnlvkvknaa
    dvsvswnlwngdagttakillngkeawsgpstgssgtanfkvnkggryqmqvalcnadgc
    tasdateivvadtdgshlpplkeslleknkpykqnsgkvvgsyfveagvygrnftvdkip
    aqnlthllygfipicggngindslkeiegsfqalqrscqgredfkisihdpfaalqkaqk
    gvtawddpykgnfgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkef
    lqtwkffdgvdidwefpggkganpnlgspqdgetyvllmkelramldqlsaetgrkyelt
    saisagkdkidkvaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtaytt
    vngvnallaqgvkpgkivvgtamygrgwtgvngyqnnipftgtatgpvkgtwengivdyr
    qiasqfmsgewqytydataeapyvfkpstgdlitfddarsvqakgkyvldkqlgglfswe
    idadngdilnsmnaslgnsagvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd6A (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdagttakillng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlpplke
    slleknkpykqnsgkvvgsyfveagvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkisihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwefpggkgan
    pnlgspqdgetyvllmkelramldqlsaetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiasqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq