PDB entry 1rd6

View 1rd6 on RCSB PDB site
Description:
Deposited on 2003-11-05, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rd6A (A:)
    mrkfnkpllalligstlcsaaqaaapgkptiawgntkfaivevdqaataynnlvkvknaa
    dvsvswnlwngdagttakillngkeawsgpstgssgtanfkvnkggryqmqvalcnadgc
    tasdateivvadtdgshlpplkeslleknkpykqnsgkvvgsyfveagvygrnftvdkip
    aqnlthllygfipicggngindslkeiegsfqalqrscqgredfkisihdpfaalqkaqk
    gvtawddpykgnfgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkef
    lqtwkffdgvdidwefpggkganpnlgspqdgetyvllmkelramldqlsaetgrkyelt
    saisagkdkidkvaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtaytt
    vngvnallaqgvkpgkivvgtamygrgwtgvngyqnnipftgtatgpvkgtwengivdyr
    qiasqfmsgewqytydataeapyvfkpstgdlitfddarsvqakgkyvldkqlgglfswe
    idadngdilnsmnaslgnsagvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd6A (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdagttakillng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlpplke
    slleknkpykqnsgkvvgsyfveagvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkisihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwefpggkgan
    pnlgspqdgetyvllmkelramldqlsaetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiasqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq