PDB entry 1rcy

View 1rcy on RCSB PDB site
Description: rusticyanin (rc) from thiobacillus ferrooxidans
Deposited on 1996-04-10, released 1997-05-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-05-15, with a file datestamp of 1997-05-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1rcy__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rcy_ (-)
ttwkeatlpqvkamlekddgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknptl
eipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgytd
ftwhptagtyyyvcqipghaatgmfgkivvk