PDB entry 1rcy

View 1rcy on RCSB PDB site
Description: rusticyanin (rc) from thiobacillus ferrooxidans
Class: metalloprotein
Keywords: metalloprotein, copper containing protein, oxidation potential, ph stability, redox protein
Deposited on 1996-04-10, released 1997-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rusticyanin
    Species: Acidithiobacillus ferrooxidans [TaxId:920]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24930 (1-150)
      • conflict (18)
      • conflict (148)
    Domains in SCOPe 2.07: d1rcya_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcyA (A:)
    ttwkeatlpqvkamlekddgkvsgdtvtysgktvhvvaaavlpgfpfpsfevhdkknptl
    eipagatvdvtfintnkgfghsfditkkgppyavmpvidpivagtgfspvpkdgkfgytd
    ftwhptagtyyyvcqipghaatgmfgkivvk