PDB entry 1rcv

View 1rcv on RCSB PDB site
Description: Cholera Toxin B-Pentamer Complexed With Bivalent Nitrophenol-Galactoside Ligand BV1
Class: toxin
Keywords: Bivalent, Cholera, Toxin, Pentamer, Complex
Deposited on 2003-11-04, released 2004-10-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.166
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rcvd_
  • Chain 'E':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rcve_
  • Chain 'F':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rcvf_
  • Chain 'G':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rcvg_
  • Chain 'H':
    Compound: cholera toxin B protein (CTB)
    Species: Vibrio cholerae [TaxId:666]
    Gene: CTXB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rcvh_
  • Heterogens: BV1, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcvD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcvE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcvF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcvG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcvH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman