PDB entry 1rcq

View 1rcq on RCSB PDB site
Description: The 1.45 A crystal structure of alanine racemase from a pathogenic bacterium, Pseudomonas aeruginosa, contains both internal and external aldimine forms
Class: isomerase
Keywords: alpha-beta barrel, beta-structure for c-terminal domain, internal/external aldimine forms, ISOMERASE
Deposited on 2003-11-04, released 2004-06-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.153
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catabolic alanine racemase DadX
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: dadx
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HTQ2 (0-356)
      • modified residue (121)
    Domains in SCOPe 2.08: d1rcqa1, d1rcqa2
  • Heterogens: PLP, DLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcqA (A:)
    mrparalidlqalrhnyrlareatgaralavikadayghgavrcaealaaeadgfavaci
    eeglelreagirqpilllegffeaselelivahdfwcvvhcawqleaieraslarplnvw
    lkmdsgmhrvgffpedfraaherlrasgkvakivmmshfsradeldcprteeqlaafsaa
    sqglegeislrnspavlgwpkvpsdwvrpgillygatpferahpladrlrpvmtleskvi
    svrdlpagepvgygarysterrqrigvvamgyadgyprhaadgtlvfidgkpgrlvgrvs
    mdmltvdltdhpqaglgsrvelwgpnvpvgalaaqfgsipyqllcnlkrvprvysga