PDB entry 1rcl

View 1rcl on RCSB PDB site
Description: the three dimensional structure of guanine-specific ribonuclease f1 in solution determined by nmr spectroscopy and distance geometry
Deposited on 1994-08-08, released 1994-11-30
The last revision prior to the SCOP 1.57 freeze date was dated 1994-11-30, with a file datestamp of 1994-12-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1rcl__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rcl_ (-)
  esattcgstnysasqvraaanaacqyyqnddtagsstyphtynnyegfdfpvdgpyqefp
  iksggvytggspgadrvvintnceyagaithtgasgnnfvgcsgtn