PDB entry 1rck

View 1rck on RCSB PDB site
Description: the three dimensional structure of guanine-specific ribonuclease f1 in solution determined by nmr spectroscopy and distance geometry
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1994-08-08, released 1994-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease f1
    Species: Gibberella fujikuroi [TaxId:5127]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10282 (1-105)
      • conflict (31)
      • conflict (35)
    Domains in SCOPe 2.06: d1rcka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rckA (A:)
    esattcgstnysasqvraaanaacqyyqnddtagsstyphtynnyegfdfpvdgpyqefp
    iksggvytggspgadrvvintnceyagaithtgasgnnfvgcsgtn