PDB entry 1rcg

View 1rcg on RCSB PDB site
Description: bullfrog red cell l ferritin sulfate/mn/ph 6.3
Deposited on 1995-08-04, released 1995-11-14
The last revision prior to the SCOP 1.55 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1rcg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcg_ (-)
    sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeekeh
    aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
    dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg