PDB entry 1rca

View 1rca on RCSB PDB site
Description: structure of the crystalline complex of deoxycytidylyl-3',5'-guanosine (3',5'-dcpdg) co-crystalised with ribonuclease at 1.9 angstroms resolution. retrobinding in pancreatic rnasea is independent of mode of inhibitor intromission
Class: hydrolase (endoribonuclease)
Keywords: hydrolase (endoribonuclease)
Deposited on 1994-07-18, released 1995-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease a
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.08: d1rcaa_
• Heterogens: PO4, CGP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rcaA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv