PDB entry 1rc9

View 1rc9 on RCSB PDB site
Description: Crystal Structure of Stecrisp, a Member of CRISP Family from Trimeresurus Stejnegeri Refined at 1.6 Angstroms Resolution: Structual relationship of the two domains
Class: toxin
Keywords: beta-alpha sandwich, double domains, short helixs motif, toxin
Deposited on 2003-11-03, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cysteine-rich secretory protein
    Species: Viridovipera stejnegeri [TaxId:39682]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rc9a1, d1rc9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rc9A (A:)
    nvdfdsesprkpeiqneivdlhnslrrsvnptasnmlrmewypeaadnaerwayrciesh
    ssyesrviegikcgeniymspypmkwtdiihawhdeykdfkygvgadppnavtghytqiv
    wyksyrigcaaaycpsspysyffvcqycpagnfigktatpytsgtpcgdcpsdcdnglct
    npctrenkftncntmvqqsscqdnymktncpascfcqnkii