PDB entry 1rc6

View 1rc6 on RCSB PDB site
Description: Crystal structure of protein Ylba from E. coli, Pfam DUF861
Class: structural genomics, unknown function
Keywords: Structural genomics, NYSGXRC, SGX clone name 3174c1TCt3b1, target T1521, Hypothetical protein Ylba from E.Coli, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, unknown function
Deposited on 2003-11-03, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ylbA
    Species: Escherichia coli [TaxId:562]
    Gene: YLBA, GLXB6, B0515
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rc6a_
  • Chain 'B':
    Compound: Hypothetical protein ylbA
    Species: Escherichia coli [TaxId:562]
    Gene: YLBA, GLXB6, B0515
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rc6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rc6A (A:)
    mgylnnvtgyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfv
    dylvtlhqnggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfv
    naqaedsqiflykrryvpvegyapwlvsgnaselerihyegmddvilldflpkelgfdmn
    mhilsfapgashgyiethvqehgayilsgqgvynldnnwipvkkgdyifmgayslqagyg
    vgrgeafsyiyskdcnrdvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rc6A (A:)
    gyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfvdylvtlhq
    nggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfvnaqaedsq
    iflykrryvpvegyapwlvsgnaselerivilldflpkelgfdmnmhilsfapgashgyi
    ethvqehgayilsgqgvynldnnwipvkkgdyifmgayslqagygvafsyiyskdcnrdv
    ei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rc6B (B:)
    mgylnnvtgyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfv
    dylvtlhqnggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfv
    naqaedsqiflykrryvpvegyapwlvsgnaselerihyegmddvilldflpkelgfdmn
    mhilsfapgashgyiethvqehgayilsgqgvynldnnwipvkkgdyifmgayslqagyg
    vgrgeafsyiyskdcnrdvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rc6B (B:)
    gyredllanraivkhgnfalltpdglvkniipgfencdatilstpklgasfvdylvtlhq
    nggnqqgfggegietflyvisgnitakaegktfalseggylycppgslmtfvnaqaedsq
    iflykrryvpvegyapwlvsgnaselerivilldflpkelgfdmnmhilsfapgashgyi
    ethvqehgayilsgqgvynldnnwipvkkgdyifmgayslqagygvafsyiyskdcnrdv
    ei