PDB entry 1rc5

View 1rc5 on RCSB PDB site
Description: crystal structure of mg(II)-complex of RNAse III endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution
Class: hydrolase
Keywords: ribonuclease, RNAse III, double-stranded RNA, RNA interference, endonuclease domain, endonucleolytic cleavage, hydrolase
Deposited on 2003-11-03, released 2004-03-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: RNC, AQ_946
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • see remark 999 (0)
    Domains in SCOPe 2.05: d1rc5a_
  • Chain 'B':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: RNC, AQ_946
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • see remark 999 (0)
      • see remark 999 (148)
    Domains in SCOPe 2.05: d1rc5b_
  • Chain 'C':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: RNC, AQ_946
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082
      • see remark 999 (0)
      • see remark 999 (148)
    Domains in SCOPe 2.05: d1rc5c_
  • Chain 'D':
    Compound: Ribonuclease III
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: RNC, AQ_946
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67082 (1-147)
      • see remark 999 (0)
    Domains in SCOPe 2.05: d1rc5d_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rc5A (A:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rc5A (A:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rc5B (B:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rc5B (B:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rc5C (C:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rc5C (C:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rc5D (D:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rc5D (D:)
    gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
    pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
    sgrdanftrelfyklfkedilsaikegr