PDB entry 1rc4

View 1rc4 on RCSB PDB site
Description: dihydrofolate reductase complexed with 5,10-dideazatetrahydrofolate and nicotinamide adenine dinucleotide phosphate (oxidized form)
Deposited on 1996-11-25, released 1997-03-12
The last revision prior to the SCOP 1.61 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1rc4__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rc4_ (-)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr