PDB entry 1rc1

View 1rc1 on RCSB PDB site
Description: Human GAR Tfase complex structure with polyglutamated 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid
Class: transferase
Keywords: protein-cofactor analogue complex, transferase
Deposited on 2003-11-03, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.235
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rc1a_
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rc1b_
  • Heterogens: PO4, KT3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rc1A (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rc1A (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rc1B (B:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rc1B (B:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv