PDB entry 1rby

View 1rby on RCSB PDB site
Description: Human GAR Tfase complex structure with 10-(trifluoroacetyl)-5,10-dideazaacyclic-5,6,7,8-tetrahydrofolic acid and substrate beta-GAR
Class: transferase
Keywords: protein-cofactor analogue complex, transferase
Deposited on 2003-11-03, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.246
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rbya_
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rbyb_
  • Chain 'C':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rbyc_
  • Chain 'D':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: PURN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rbyd_
  • Heterogens: KEU, GAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rbyA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbyA (A:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rbyB (B:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbyB (B:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rbyC (C:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbyC (C:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rbyD (D:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwvkeehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rbyD (D:)
    arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
    yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
    heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
    lqlvasgtvqlgengkicwv