PDB entry 1rbl

View 1rbl on RCSB PDB site
Description: structure determination and refinement of ribulose 1,5 bisphosphate carboxylase(slash)oxygenase from synechococcus pcc6301
Class: lyase
Keywords: lyase(carbon-carbon), lyase
Deposited on 1993-05-12, released 1994-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00880 (0-466)
      • conflict (32-33)
      • conflict (82)
      • conflict (347)
    Domains in SCOPe 2.07: d1rbla1, d1rbla2
  • Chain 'B':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00880 (0-466)
      • conflict (32-33)
      • conflict (82)
      • conflict (347)
    Domains in SCOPe 2.07: d1rblb1, d1rblb2
  • Chain 'C':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00880 (0-466)
      • conflict (32-33)
      • conflict (82)
      • conflict (347)
    Domains in SCOPe 2.07: d1rblc1, d1rblc2
  • Chain 'D':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00880 (0-466)
      • conflict (32-33)
      • conflict (82)
      • conflict (347)
    Domains in SCOPe 2.07: d1rbld1, d1rbld2
  • Chain 'E':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00880 (0-466)
      • conflict (32-33)
      • conflict (82)
      • conflict (347)
    Domains in SCOPe 2.07: d1rble1, d1rble2
  • Chain 'F':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00880 (0-466)
      • conflict (32-33)
      • conflict (82)
      • conflict (347)
    Domains in SCOPe 2.07: d1rblf1, d1rblf2
  • Chain 'G':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00880 (0-466)
      • conflict (32-33)
      • conflict (82)
      • conflict (347)
    Domains in SCOPe 2.07: d1rblg1, d1rblg2
  • Chain 'H':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00880 (0-466)
      • conflict (32-33)
      • conflict (82)
      • conflict (347)
    Domains in SCOPe 2.07: d1rblh1, d1rblh2
  • Chain 'I':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (0-108)
      • conflict (62)
      • conflict (64-65)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.07: d1rbli_
  • Chain 'J':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (0-108)
      • conflict (62)
      • conflict (64-65)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.07: d1rblj_
  • Chain 'K':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (0-108)
      • conflict (62)
      • conflict (64-65)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.07: d1rblk_
  • Chain 'L':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (0-108)
      • conflict (62)
      • conflict (64-65)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.07: d1rbll_
  • Chain 'M':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (0-108)
      • conflict (62)
      • conflict (64-65)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.07: d1rblm_
  • Chain 'N':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (0-108)
      • conflict (62)
      • conflict (64-65)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.07: d1rbln_
  • Chain 'O':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (0-108)
      • conflict (62)
      • conflict (64-65)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.07: d1rblo_
  • Chain 'P':
    Compound: ribulose 1,5 bisphosphate carboxylase/oxygenase (small chain)
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:269084]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04716 (0-108)
      • conflict (62)
      • conflict (64-65)
      • conflict (95)
      • conflict (99)
    Domains in SCOPe 2.07: d1rblp_
  • Heterogens: MG, CAP, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblA (A:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblB (B:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblC (C:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblD (D:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblE (E:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblF (F:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblG (G:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblH (H:)
    saagykagvkdykltyytpdytpkdtdllaafrfspqpgvpadeagaaiaaesstgtwtt
    vwtdlltdmdrykgkcyhiepvageensyfafiaypldlfeegsvtniltsivgnvfgfk
    airslrledirfpvalvktfqgpphgiqverdllnkygrpmlgctikpklglsaknygra
    vyeclrggldftkddeninsqpfqrwrdrflfvadaihksqaetgeikghylnvtaptce
    emmkraefakelgmpiimhdfltagftanttlakwcrdngvllhihramhavidrqrnhg
    ihfrvlakclrlsggdhlhsgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdw
    asmpgvlpvasggihvwhmpalveifgddsvlqfgggtlghpwgnapgatanrvaleacv
    qarnegrdlyreggdilreagkwspelaaaldlwkeikfefetmdkl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblI (I:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblJ (J:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblK (K:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblL (L:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblM (M:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblN (N:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblO (O:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rblP (P:)
    smktlpkerrfetfsylpplsdrqiaaqieymieqgfhpliefnehsnpeefywtmwklp
    lfacaapqqvldevrecrseygdcyirvagfdnikecqtssfivhrpgr