PDB entry 1rbj

View 1rbj on RCSB PDB site
Description: ribonuclease b complex with d(tetra-(deoxy-adenylate))
Class: hydrolase/DNA
Keywords: protein-DNA complex, hydrolase/DNA complex
Deposited on 1995-05-22, released 1995-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.163
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease b (e.c.3.1.27.5))
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rbja_
  • Chain 'B':
    Compound: DNA (5'-d(*ap*ap*ap*a)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rbjA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

  • Chain 'B':
    No sequence available.