PDB entry 1rbd

View 1rbd on RCSB PDB site
Description: crystallographic structures of ribonuclease s variants with nonpolar substitution at position 13: packing and cavities
Class: hydrolase(phosphoric diester,RNA)
Keywords: hydrolase(phosphoric diester, RNA)
Deposited on 1992-06-12, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease s (s-protein)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rbd.1
  • Chain 'S':
    Compound: ribonuclease s (s-peptide)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rbd.1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rbdA (A:)
    sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
    itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rbdS (S:)
    ketaaakferqhads