PDB entry 1rbc

View 1rbc on RCSB PDB site
Description: crystallographic structures of ribonuclease s variants with nonpolar substitution at position 13: packing and cavities
Deposited on 1992-06-12, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1rbc__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rbc_ (-)
  sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
  itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv