PDB entry 1rb4
View 1rb4 on RCSB PDB site
Description: antiparallel trimer of gcn4-leucine zipper core mutant as n16a tetragonal automatic solution
Class: DNA binding protein
Keywords: coiled coil, peptide, leucine zipper, automation
Deposited on
2003-11-01, released
2004-01-13
The last revision prior to the SCOP 1.73 freeze date was dated
2004-02-17, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.204
AEROSPACI score: -1.5
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: General control protein GCN4
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1rb4a_ - Chain 'B':
Compound: General control protein GCN4
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1rb4b_ - Chain 'C':
Compound: General control protein GCN4
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1rb4c_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1rb4A (A:)
rmkqledkveellskayhlenevarlkklvger
Sequence, based on observed residues (ATOM records): (download)
>1rb4A (A:)
rmkqledkveellskayhlenevarlkklv
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1rb4B (B:)
rmkqledkveellskayhlenevarlkklvger
Sequence, based on observed residues (ATOM records): (download)
>1rb4B (B:)
rmkqledkveellskayhlenevarlkklvge
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1rb4C (C:)
rmkqledkveellskayhlenevarlkklvger
Sequence, based on observed residues (ATOM records): (download)
>1rb4C (C:)
rmkqledkveellskayhlenevarlkkl