PDB entry 1rav

View 1rav on RCSB PDB site
Description: recombinant avidin
Deposited on 1998-03-27, released 1998-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1998-07-15, with a file datestamp of 1998-07-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1rava_
  • Chain 'B':
    Domains in SCOP 1.55: d1ravb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ravA (A:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlrt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ravB (B:)
    rkcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtentinkrtq
    ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
    rlrt