PDB entry 1ras

View 1ras on RCSB PDB site
Description: crystal structure of a fluorescent derivative of rnase a
Deposited on 1993-03-02, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.203
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ras__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ras_ (-)
etaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsqk
nvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfd
asv