PDB entry 1raq

View 1raq on RCSB PDB site
Description: the structure and function of omega loop a replacements in cytochrome c
Class: electron transport
Keywords: electron transport
Deposited on 1992-08-25, released 1993-10-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rep a2 iso-1-cytochrome c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-107)
      • conflict (25-26)
      • conflict (29-30)
    Domains in SCOPe 2.04: d1raqa_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1raqA (A:)
    tefkagsakkgatlfktrclqchtvdqggankvgpnlhgifgrhsgqaegysytdanikk
    nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace