PDB entry 1raq

View 1raq on RCSB PDB site
Description: the structure and function of omega loop a replacements in cytochrome c
Class: electron transport
Keywords: electron transport
Deposited on 1992-08-25, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rep a2 iso-1-cytochrome c
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00044 (0-107)
    • conflict (25-26)
    • conflict (29-30)
  Domains in SCOP 1.73: d1raqa_
• Heterogens: SO4, TML, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1raqA (A:)
  tefkagsakkgatlfktrclqchtvdqggankvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace