PDB entry 1rap

View 1rap on RCSB PDB site
Description: the structure and function of omega loop a replacements in cytochrome c
Deposited on 1992-08-25, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.25 Å
R-factor: 0.183
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1rap__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rap_ (-)
  tefkagsakkgatlfktrclqchtfdqggankvgpnlhgifgrhsgqaegysytdanikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace