PDB entry 1ram

View 1ram on RCSB PDB site
Description: a novel DNA recognition mode by nf-kb p65 homodimer
Class: transcription/DNA
Keywords: complex (transcription factor/DNA), DNA-binding, transcription regulation, rel, activator, nuclear protein, phosphorylation, conformation, transcription/DNA complex
Deposited on 1997-11-22, released 1998-05-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (transcription factor nf-kb p65)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1rama1, d1rama2
  • Chain 'B':
    Compound: protein (transcription factor nf-kb p65)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ramb1, d1ramb2
  • Chain 'C':
    Compound: DNA (5'-d(*cp*gp*gp*cp*tp*gp*gp*ap*ap*ap*tp*tp*tp*cp*cp*ap*gp*cp*cp*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*gp*gp*cp*tp*gp*gp*ap*ap*ap*tp*tp*tp*cp*cp*ap*gp*cp*cp*g)-3')
  • Heterogens: DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ramA (A:)
    pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
    kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
    npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapntaelkicr
    vnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppya
    dpslqapvrvsmqlrrpsdrelsepmefqylpd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ramB (B:)
    pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
    kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
    npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapntaelkicr
    vnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppya
    dpslqapvrvsmqlrrpsdrelsepmefqylpd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.