PDB entry 1rak

View 1rak on RCSB PDB site
Description: Bacterial cytosine deaminase D314S mutant bound to 5-fluoro-4-(S)-hydroxyl-3,4-dihydropyrimidine.
Class: hydrolase
Keywords: CYTOSINE DEAMINASE, ALPHA-BETA BARREL, HEXAMER, CONFORMATIONAL CHANGE, D314S mutant
Deposited on 2003-10-31, released 2004-10-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.172
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Escherichia coli
    Gene: CODA, B0337
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25524 (Start-429)
      • engineered (317)
    Domains in SCOP 1.73: d1raka1, d1raka2
  • Heterogens: FE, FPY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rakA (A:)
    gssmannalqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipp
    fvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangi
    qhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlg
    advvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhe
    gmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgit
    rvkemlesginvcfghdsvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithh
    sartlnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl
    eqpeaidykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rakA (A:)
    alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippfvephih
    ldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangiqhvrthv
    dvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlgadvvgai
    phfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhegmgarvt
    ashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgitrvkemle
    sginvcfghdsvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithhsartlnl
    qdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaid
    ykr