PDB entry 1rak

View 1rak on RCSB PDB site
Description: Bacterial cytosine deaminase D314S mutant bound to 5-fluoro-4-(S)-hydroxyl-3,4-dihydropyrimidine.
Deposited on 2003-10-31, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-04, with a file datestamp of 2005-01-04.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.172
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rakA (A:)
    gssmannalqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipp
    fvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangi
    qhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlg
    advvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhe
    gmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgit
    rvkemlesginvcfghdsvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithh
    sartlnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl
    eqpeaidykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rakA (A:)
    alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippfvephih
    ldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangiqhvrthv
    dvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlgadvvgai
    phfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhegmgarvt
    ashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgitrvkemle
    sginvcfghdsvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithhsartlnl
    qdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaid
    ykr