PDB entry 1ra9

View 1ra9 on RCSB PDB site
Description: dihydrofolate reductase complexed with nicotinamide adenine dinucleotide phosphate (oxidized form)
Deposited on 1996-10-28, released 1996-12-23
The last revision prior to the SCOP 1.57 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.169
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1ra9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ra9_ (-)
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr