PDB entry 1ra5

View 1ra5 on RCSB PDB site
Description: Bacterial cytosine deaminase D314A mutant bound to 5-fluoro-4-(S)-hydroxyl-3,4-dihydropyrimidine.
Class: hydrolase
Keywords: CYTOSINE DEAMINASE, ALPHA-BETA BARREL, HEXAMER, CONFORMATIONAL CHANGE, D314A mutant, HYDROLASE
Deposited on 2003-10-31, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.183
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: CODA, B0337
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25524 (Start-429)
      • engineered (317)
    Domains in SCOPe 2.07: d1ra5a1, d1ra5a2
  • Heterogens: FE, FPY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ra5A (A:)
    gssmannalqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipp
    fvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangi
    qhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlg
    advvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhe
    gmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgit
    rvkemlesginvcfghdavfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithh
    sartlnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl
    eqpeaidykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ra5A (A:)
    alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippfvephih
    ldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangiqhvrthv
    dvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlgadvvgai
    phfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhegmgarvt
    ashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgitrvkemle
    sginvcfghdavfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithhsartlnl
    qdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaid
    ykr