PDB entry 1r9x

View 1r9x on RCSB PDB site
Description: Bacterial cytosine deaminase D314G mutant.
Class: hydrolase
Keywords: cytosine deaminase, hydrolase, alpha-beta barrel, hexamer, domain swap, D314G mutant
Deposited on 2003-10-31, released 2004-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.164
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytosine deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: CODA, B0337
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25524 (Start-429)
      • engineered (317)
    Domains in SCOPe 2.06: d1r9xa1, d1r9xa2
  • Heterogens: FE, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r9xA (A:)
    gssmannalqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipp
    fvephihldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangi
    qhvrthvdvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlg
    advvgaiphfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhe
    gmgarvtashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgit
    rvkemlesginvcfghdgvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithh
    sartlnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl
    eqpeaidykr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r9xA (A:)
    alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippfvephih
    ldttqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtlkwqiangiqhvrthv
    dvsdatltalkamlevkqevapwidlqivafpqegilsypngealleealrlgadvvgai
    phfeftreygveslhktfalaqkydrlidvhcdeiddeqsrfvetvaalahhegmgarvt
    ashttamhsyngaytsrlfrllkmsginfvanplvnihlqgrfdtypkrrgitrvkemle
    sginvcfghdgvfdpwyplgtanmlqvlhmglhvcqlmgygqindglnlithhsartlnl
    qdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaid
    ykr