PDB entry 1r9w

View 1r9w on RCSB PDB site
Description: Crystal Structure of the DNA-binding domain of the human papillomavirus type 18 (HPV-18) replication initiation protein E1
Class: replication
Keywords: HPV-18, papillomavirus, DNA-binding domain, viral replication, initiator protein
Deposited on 2003-10-31, released 2003-11-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.213
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: replication protein e1
    Species: Human papillomavirus type 18 [TaxId:333761]
    Gene: E1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1r9wa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1r9wA (A:)
kqgamlavfkdtyglsftdlvrnfksdkttctdwvtaifgvnptiaegfktliqpfilya
hiqcldckwgvlilallrykcgksrltvakglstllhvpetcmliqppklrssvaalywy
rtgisnisevmgdtpewiqrltiiq

    Sequence, based on observed residues (ATOM records): (download) 
    >1r9wA (A:)
kqgamlavfkdtyglsftdlvrtctdwvtaifgvnptiaegfktliqpfilyahiqcldc
kwgvlilallrykcgksrltvakglstllhvpetcmliqppklrssvaalywyrtgisni
sevmgdtpewiqrltiiq