PDB entry 1r9q

View 1r9q on RCSB PDB site
Description: structure analysis of ProX in complex with proline betaine
Class: protein binding
Keywords: periplasmic binding protein, cation-pi interactions, tryptophan box, PROTEIN BINDING
Deposited on 2003-10-30, released 2004-02-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycine betaine-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Gene: proX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1r9qa_
  • Heterogens: UNX, PBE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r9qA (A:)
    adlpgkgitvnpvqstiteetfqtllvsraleklgytvnkpsevdynvgytslasgdatf
    tavnwtplhdnmyeaaggdkkfyregvfvngaaqgylidkktadqykitniaqlkdpkia
    klfdtngdgkadltgcnpgwgcegainhqlaayeltntvthnqgnyaammadtisrykeg
    kpvfyytwtpywvsnelkpgkdvvwlqvpfsalpgdknadtklpnganygfpvstmhiva
    nkawaeknpaaaklfaimqlpvadinaqnaimhdgkasegdiqghvdgwikahqqqfdgw
    vnealaaqk