PDB entry 1r9p

View 1r9p on RCSB PDB site
Description: Solution NMR Structure Of The Haemophilus Influenzae Iron-Sulfur Cluster Assembly Protein U (IscU) with Zinc Bound at the Active Site. Northeast Structural Genomics Consortium Target IR24.
Class: structural genomics, unknown function
Keywords: iron-sulfur cluster binding, zinc binding, three conserved Cys, 3beta strands, 4 alpha helixes, NESG, STRUCTURAL GENOMICS, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2003-10-30, released 2004-11-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NifU-like protein
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HI0377
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57074 (0-125)
      • cloning artifact (126-127)
      • expression tag (128-133)
    Domains in SCOPe 2.03: d1r9pa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1r9pA (A:)
    maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfkt
    ygcgsaiassslitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiad
    ykakqglehhhhhh